PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009612035.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 350aa    MW: 39115.3 Da    PI: 6.3705
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009612035.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-153178148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W+ Iar  g+ R++k+c++rw +yl
   XP_009612035.1 31 KGLWSPEEDEKLMNYMLTNGQGCWSDIARNAGLQRCGKSCRLRWINYL 78
                     678*******************************************97 PP

2Myb_DNA-binding50.35.7e-1684127146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+e +v+++  lG++ W+ Ia++++ gRt++++k++w++
   XP_009612035.1  84 RGAFSPQEEEHIVHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNS 127
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-232481IPR009057Homeodomain-like
PROSITE profilePS5129416.7682678IPR017930Myb domain
SuperFamilySSF466893.97E-2829125IPR009057Homeodomain-like
SMARTSM007173.9E-113080IPR001005SANT/Myb domain
PfamPF002497.8E-143178IPR001005SANT/Myb domain
CDDcd001678.42E-103478No hitNo description
PROSITE profilePS5129424.2979133IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-2582134IPR009057Homeodomain-like
SMARTSM007175.4E-1483131IPR001005SANT/Myb domain
PfamPF002493.1E-1484127IPR001005SANT/Myb domain
CDDcd001675.85E-1086126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MRKPDHSSSM MKEKGNSCNN NNNNTKAKLR KGLWSPEEDE KLMNYMLTNG QGCWSDIARN  60
AGLQRCGKSC RLRWINYLRP DLKRGAFSPQ EEEHIVHLHS ILGNRWSQIA ARLPGRTDNE  120
IKNFWNSTIK KRLKNNNNNN NNNTLSPNTS DSSSDPRALM GGIIPMQGHD VNHVMAALCM  180
DNSSSTSNHF NPFPQLDSTN YDIIGAGLYN FPPCLGQFDG DAGVVDYGVV ENYSTMGLGS  240
DFSVPTLEGG GNKSMGENNN NVNFSSSNIN AANIDYNSMI EKKINGNNNQ QLMLSETSSD  300
QSLKVEDYMV GFGNHHQHHW HGESLRMGEF DWEGLLANVS SLPYLDFQVE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26291335108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754405e-73HG975440.1 Solanum pennellii chromosome ch01, complete genome.
GenBankHG9755135e-73HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009612035.10.0PREDICTED: myb-related protein Hv33-like
RefseqXP_016432968.10.0PREDICTED: myb-related protein Hv33-like
TrEMBLM1A9C01e-164M1A9C0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000177091e-163(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.15e-67myb domain protein 83